PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003700.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 186aa    MW: 20822.9 Da    PI: 7.9957
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003700.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM60.36.2e-192674251
                      NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
                              pGfrFhPtdeelv +yL+++ve+k++++ e ik+vdiyk++PwdLp++ 
  Itr_sc003700.1_g00004.1 26 LPGFRFHPTDEELVGFYLRRRVENKRISI-ELIKQVDIYKHDPWDLPRQP 74
                             69***************************.89**************9532 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-1824110IPR003441NAC domain
PROSITE profilePS5100516.2325180IPR003441NAC domain
PfamPF023655.5E-82768IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MEAKKMVVAV AAAAAVEKDE DEEVILPGFR FHPTDEELVG FYLRRRVENK RISIELIKQV  60
DIYKHDPWDL PRQPEWQDQD ARGREDHRAR VPPCGPLPAR ITGRGFTHIL GRGVRFASIN  120
PILMVISTYM QDSVAWWQSG SPITMQSGSF KRRLSSHGQG CQPLQAIIVG DASVCVASPP  180
PCTVHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-15171116100Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283251.12e-30PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK553e-28NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLE0CU172e-30E0CU17_VITVI; Putative uncharacterized protein
STRINGVIT_12s0028g00860.t016e-30(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1649745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-27NAC domain containing protein 42